PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK16587.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family TALE
Protein Properties Length: 388aa    MW: 43899 Da    PI: 6.6502
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK16587.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093143482155
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                k +yps++++  LA+++gL+++q+ +WF N+R ++
  PK16587.1 314 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 348
                569*****************************885 PP

2ELK414e-14268289122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK qLlrKYsgyLgsLkqEF+
  PK16587.1 268 ELKGQLLRKYSGYLGSLKQEFM 289
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-20129173IPR005540KNOX1
PfamPF037901.2E-21132169IPR005540KNOX1
SMARTSM012562.1E-25180231IPR005541KNOX2
PfamPF037914.0E-20184229IPR005541KNOX2
SMARTSM011882.8E-8268289IPR005539ELK domain
PROSITE profilePS5121311.174268288IPR005539ELK domain
PfamPF037896.5E-11268289IPR005539ELK domain
PROSITE profilePS5007112.989288351IPR001356Homeobox domain
SuperFamilySSF466891.63E-19290366IPR009057Homeodomain-like
SMARTSM003897.4E-13290355IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-28293353IPR009057Homeodomain-like
CDDcd000863.81E-12300352No hitNo description
PfamPF059207.2E-17308347IPR008422Homeobox KN domain
PROSITE patternPS000270326349IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEGGSNGTSC MMGYGENSNG ICPMMMMMPI MTSHHGQHHH NHPNNNPNAN TNNTPIFLPL  60
PSLNNQDHRN RISNSSGSSS FMVEDSHQNN NNNNNNTNNI PTPGCYFMAD HNTNTITNNN  120
NNDSINNISS FKAKIMAHPH YPRLLAAYVN CQKVGAPVEV VGRLEEACSS AAAMGQMSSS  180
TGCLGEDPAL DQFMEAYCEM LTKYEQELSK PFKEAMLFLQ RVECQFKALS LSTDSGCRDG  240
NVDQNNGSSE EEIDVNNNFI DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE  300
ARQQLLDWWS RHYKWPYPSE SQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVM  360
DAAHPHHFYM DNVLANNHFP MDISPSLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1283292LKQEFMKKRK
2289293KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002564.11e-176PREDICTED: homeobox protein SBH1
SwissprotP466081e-147HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLQ5XLC91e-179Q5XLC9_POPCN; Homeodomain protein ARBORKNOX1
STRINGVIT_12s0059g01190.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-137KNOX/ELK homeobox transcription factor